PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG134100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 735aa    MW: 83041.2 Da    PI: 7.7235
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG134100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.83.9e-1033567261374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+av+++d +la++l++++++++spdgd +qRla+y++ +L+arla+ +s+ly++l +++ +    +e+++++k+   ++ +
  Pavir.1KG134100.1.p 356 LRTLLIHCAQAVAADDRQLATELIKKIRQHSSPDGDCTQRLAFYLVDGLEARLAGVGSQLYRKLLAKRVP---DEEVFKIYKFSLAAFLL 442
                          6789************************************************************999998...6788889999899999* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          ++ s+  aN++I ea  g  +vHiiDf+i  G+QWp+L+q++a++ + pp+lRiTg++  ++g    e +e+ g+rLa++A+ ++vpf++
  Pavir.1KG134100.1.p 443 HRASYAFANRTIIEASRGRLKVHIIDFGICFGFQWPSLIQQFAEQ-GVPPMLRITGIDVTRPGfgTLEITEQAGKRLADYANMFKVPFQY 531
                          ********************************************6.889**********99989899999******************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +++r+e+++le+L+++++E ++Vn+ +++++l de+vs++s+rd+vLkl+++++Pkv+v+   + +++s+ F +rf e l +ys++f
  Pavir.1KG134100.1.p 532 QG-ISSRFENVQLEDLNIEEDELVIVNCLYRMKSLGDETVSMNSARDRVLKLMRRINPKVLVLGVVNGSYSSPFFITRFKELLFHYSSVF 620
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d+++a++pr++e+r+ +E ++l+re+ n++acegaer er et+++W++r  +aGF+++p++  + +++  + + ++ + +  +e+sg+l
  Pavir.1KG134100.1.p 621 DMFDANAPRDNEARKLLEGRVLAREAINIIACEGAERSERPETFKQWQARCLKAGFEQLPIDPAILNSILEMKKAIYHEDFFADEDSGWL 710
                          *****************************************************************************999********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          ++gWk+r + ++S W+
  Pavir.1KG134100.1.p 711 LQGWKGRVMHAISKWK 726
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.517330706IPR005202Transcription factor GRAS
PfamPF035141.3E-100356726IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MVIEPLFDDL HTITRTEQPC DGSSSSSQQQ LTAYNYSLSG SQFFPQPTHN ESNAEISDLV  60
TIPGMYNVTS NLGQNQLQFS AGVSPDYHQR IRSNNALHNI SQMLMEDVDE RVGLHEGEAA  120
LHAAEKAFYD ILEQVYPPSW PPLCTSNEAD GPDESRNNYQ KRPRRTSSTS DVSSHSMLHP  180
LPAPVSPYNY GRSLFMPYQP STSTGRAARF GFPAFQIIRS AEDAKGFDKL VIYLDSGKLS  240
ICRLTTKAKV VEKSKYAVFQ ITDHRGSKYP YIQDLNAREG SSSKQHTNTI TCEISENRKF  300
DTVLLCYRLD CFNDTISLRE SMAKQASKDS PKGQSKGTAQ QKLRGKRQIS KEVVDLRTLL  360
IHCAQAVAAD DRQLATELIK KIRQHSSPDG DCTQRLAFYL VDGLEARLAG VGSQLYRKLL  420
AKRVPDEEVF KIYKFSLAAF LLHRASYAFA NRTIIEASRG RLKVHIIDFG ICFGFQWPSL  480
IQQFAEQGVP PMLRITGIDV TRPGFGTLEI TEQAGKRLAD YANMFKVPFQ YQGISSRFEN  540
VQLEDLNIEE DELVIVNCLY RMKSLGDETV SMNSARDRVL KLMRRINPKV LVLGVVNGSY  600
SSPFFITRFK ELLFHYSSVF DMFDANAPRD NEARKLLEGR VLAREAINII ACEGAERSER  660
PETFKQWQAR CLKAGFEQLP IDPAILNSIL EMKKAIYHED FFADEDSGWL LQGWKGRVMH  720
AISKWKPNES WSDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-363606818328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963450.10.0PREDICTED: uncharacterized protein LOC101786830
SwissprotO809331e-141SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZCE30.0K3ZCE3_SETIT; Uncharacterized protein
STRINGSi024218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-142GRAS family protein